PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G264300.1
Common NamePHAVU_002G264300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NF-YB
Protein Properties Length: 226aa    MW: 24822.6 Da    PI: 7.5694
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G264300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB180.41.5e-5627122297
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl++yre
  Phvul.002G264300.1  27 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKLYLHNYRE 117
                         89***************************************************************************************** PP

               NF-YB  93 legek 97 
                         +egek
  Phvul.002G264300.1 118 TEGEK 122
                         **997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.3E-5523143IPR009072Histone-fold
SuperFamilySSF471133.11E-4129141IPR009072Histone-fold
PfamPF008082.7E-273296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-186078No hitNo description
PROSITE patternPS0068506379IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.4E-187997No hitNo description
PRINTSPR006152.4E-1898116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MTGKRNQTII SPVGSPTSGN ISDSSSKEQD RFLPIANVSR IMKRALPANA KISKEAKETV  60
QECVSEFISF ITGEASDKCQ REKRKTINGD DLLWAMTTLG FENYVGPLKL YLHNYRETEG  120
EKSSMAKQEE HSPTDQTHQT NDGVSELNKL PHSVTTKADF NTFSGGFYSV GSRVTAPKTF  180
TDIGGINGYR DSSMNSIIAQ SAVSGDQDAS GNRLMPPNLR YRVEW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B5e-4827117292Transcription factor HapC (Eurofung)
4g92_B5e-4827117292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159754.11e-170hypothetical protein PHAVU_002G264300g
TrEMBLV7CQX41e-170V7CQX4_PHAVU; Uncharacterized protein
STRINGGLYMA05G31681.11e-132(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-64nuclear factor Y, subunit B3